PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000199840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 304aa    MW: 34628.6 Da    PI: 7.0021
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000199840genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.93.1e-5661331128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                    lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v s
  MDP0000199840   6 LPPGFRFHPTDEELVAYYLDRKINGRTIEL-EIIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVSS 100
                    79****************************.99**************96435566888*************************************9 PP

            NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     ++++vg+kktLv+y+grap+g +t+Wvmheyrl
  MDP0000199840 101 -QRRAVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133
                    .8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-643157IPR003441NAC domain
PROSITE profilePS5100560.7016157IPR003441NAC domain
PfamPF023654.1E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDRKING RTIELEIIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRAVSS QRRAVGMKKT LVYYRGRAPH  120
GIRTNWVMHE YRLVDSVCAN ASSSLKDSYA LCRVFKKTIQ MPKNNKEEKP IGINNADKDS  180
IWVSNEQLFG EENSGINEGA SRGIETDQDE NYSTHGYPKF PSDTSSSDLT QGTPTENGIA  240
DDLQATFASD EANSSADLYS FGVHCSSDLV QVCTKYHVQF HFFGTIHLRA HDRKWYSGIS  300
WVIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-61115712165NO APICAL MERISTEM PROTEIN
1ut4_B6e-61115712165NO APICAL MERISTEM PROTEIN
1ut7_A6e-61115712165NO APICAL MERISTEM PROTEIN
1ut7_B6e-61115712165NO APICAL MERISTEM PROTEIN
4dul_A6e-61115712165NAC domain-containing protein 19
4dul_B6e-61115712165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371963.10.0PREDICTED: protein BEARSKIN1-like
SwissprotQ9FFI57e-92NAC86_ARATH; NAC domain-containing protein 86
TrEMBLM5WNI40.0M5WNI4_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s18180.11e-150(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF105083341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.16e-97NAC domain containing protein 20